PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02662.1.p
Common NameEUGRSUZ_I02662, LOC104419906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CAMTA
Protein Properties Length: 1057aa    MW: 118301 Da    PI: 6.0314
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02662.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1183.91.8e-57211363118
              CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfq 95 
                       + ++rwl++ ei++iL n++k+++++e++trp+sgsl+L++rk++ryfrkDG++w+kk+dgktv+E+hekLKvg+v+vl+cyYah+een++fq
  Eucgr.I02662.1.p  21 EAQHRWLRPAEICEILRNHQKFQIAAEPPTRPPSGSLFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQ 113
                       449****************************************************************************************** PP

              CG-1  96 rrcywlLeeelekivlvhylevk 118
                       rr+yw+Le++l +iv+vhylevk
  Eucgr.I02662.1.p 114 RRSYWMLEQDLMHIVFVHYLEVK 136
                       ********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143784.14815141IPR005559CG-1 DNA-binding domain
SMARTSM010761.1E-8318136IPR005559CG-1 DNA-binding domain
PfamPF038595.2E-5121135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.105.9E-5454553IPR013783Immunoglobulin-like fold
PfamPF018332.1E-4479551IPR002909IPT domain
SuperFamilySSF812969.0E-13479563IPR014756Immunoglobulin E-set
CDDcd002041.29E-15635760No hitNo description
PROSITE profilePS5029719.253637757IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.12E-17651764IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-16655764IPR020683Ankyrin repeat-containing domain
PfamPF127961.9E-6663730IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.549672704IPR002110Ankyrin repeat
SMARTSM002482100672701IPR002110Ankyrin repeat
SMARTSM002480.0064705734IPR002110Ankyrin repeat
PROSITE profilePS500889.484705737IPR002110Ankyrin repeat
SuperFamilySSF525402.92E-8878930IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.43879901IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.316881909IPR000048IQ motif, EF-hand binding site
PfamPF006120.0023883900IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0016902924IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.432903927IPR000048IQ motif, EF-hand binding site
PfamPF006122.2E-4905924IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1057 aa     Download sequence    Send to blast
MAQRGSYGLT PQLDIEQLQV EAQHRWLRPA EICEILRNHQ KFQIAAEPPT RPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKRD GKTVKEAHEK LKVGSVDVLH CYYAHGEENE NFQRRSYWML  120
EQDLMHIVFV HYLEVKGNRA NVSGVRENEE SARSFQKDSP PSYSYSMNHS SALSGNTDST  180
SPTSTLTSLC EDADSEETHR NNSGLRTFPS SLQKEKGSPV NNNAMSSSAY FPSSYPENHK  240
GWSLRPDVNA TSTTHVDGST DIGSGIQSQK SLGLASWEDI LKQSMSGSAA VPSHVPSSSS  300
QTIPSGAVFG QENIVLSELL GGESVSKQHI SIPASTQSHW QVSGEDGPWT MDQSLDLDLD  360
LAYEPDIRFL EQIKQNSESQ DASGGLNQQY EHLEANEDKN VPVGGEANYA FAARRLLSDG  420
EDGLKKVDSF SRWITKELGD VEDLKVQSTS GLPWSTVECG NVEDSSLGPS LSQDQLFSIR  480
DFSPKWAYGN SGIKVLIMGT FLKNQQEVAK YNWSCMFGEV EVPTTVLADG ILSCRTPHVI  540
GRVPFYITCS NRLACSEVRE FDFRAGSTKG VDISEIYDND LEEMHLHLQL ERLLSSNAAG  600
HPDNSVEGLL EKRDLIDKII GLKDEEESYR VNLYLHEAKE ELHQKLLREK LYSWLLHKVI  660
EDGKGPCVLD EQGQGVIHLA AALGYNWAIK PILSAGISIN FRDVNGWTAL HWAAFRGREQ  720
TVAVLLSLDA TPGVPSDPSP EYPLGRTPAD LASVNGHKGI SGFIAECMLT SYLEPLTVND  780
PKEDSPSEVN EKKAVQTISE RSPTPLGDGD MPDVLSLKDS LNAVCNATQA AHRIHQMFRI  840
QSFQRKKLET GDYASEYSDE QAIAFVTSKN RGTWLSDGLV HGAAIQIQKK FRGWKKRKEF  900
LNIRQRIVKI QAHVRGHQVR KQYKTIIWSV GILEKIILRW RRKGSGLRGY RSDALNKHTS  960
QQALPQKEDD YDFLKDGRKQ TEERLQKALT RVKSMAQYPE ARSQYRRLLN VVEGMRENKA  1020
HDMVLSNSAE VADGEEDLLD IDSLLDDDTL MSITFD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02662.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030039.10.0PREDICTED: calmodulin-binding transcription activator 2-like
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A059AT270.0A0A059AT27_EUCGR; Uncharacterized protein
STRINGGLYMA08G07680.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40822452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains